SCOP 1.67: Domain d1idjb_: 1idj B:

Lineage for d1idjb_ (1idj B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (7 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.1: Pectin lyase-like [51126] (11 families)
   superhelix turns are made of 3 strands each

5. Family b.80.1.2: Pectin lyase [51133] (1 protein)
   this is a repeat family; one repeat unit is 1idj A:227-250 found in domain

6. Protein Pectin lyase [51134] (2 species)

7. Species Aspergillus niger, type A [TaxId:5061] [51135] (2 PDB entries)

8. Domain d1idjb_: 1idj B: [28027]

Details for d1idjb_

PDB Entry: 1idj, 2.4 Å

PDB Description: pectin lyase a

SCOP Domain Sequences for d1idjb_:

Sequence; same for both SEQRES and ATOM records:

>d1idjb_ b.80.1.2 (B:) Pectin lyase {Aspergillus niger, type A}
vgvsgsaegfaegvtgggdatpvypdtidelvsylgddearvivltktfdftdsegtttg
tgcapwgtasacqvaidqddwcenyepdapsvsveyynagvlgitvtsnksligegssga
ikgkglrivsgaeniiiqniavtdinpkyvwggdaitlddcdlvwidhvttarigrqhyv
lgtsadnrvsltnnyidgvsdysatcdgyhywgiyldgdadlvtmkgnyiyhtsgrspkv
qdntllhcvnnyfydisghafeigeggyvlaegnvfqnvdtvletyegaaftvpsttage
vcstylgrdcvingfgcsgtfsedstsflsdfegkniasasaytsvasrvvanagqgnl

Timeline for d1idjb_:

• d1idjb_ first appeared (with stable ids) in SCOP 1.55
  
• d1idjb_ appears in SCOP 1.65
  
• d1idjb_ appears in SCOP 1.69
  
• d1idjb_ appears in the current release, SCOPe 2.08