Lineage for d5c88b_ (5c88 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968970Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2968971Protein automated matches [190038] (49 species)
    not a true protein
  7. 2969474Species Sulfolobus solfataricus [TaxId:273057] [267809] (6 PDB entries)
  8. 2969481Domain d5c88b_: 5c88 B: [280268]
    Other proteins in same PDB: d5c88a2
    automated match to d4lx9a_
    complexed with coa

Details for d5c88b_

PDB Entry: 5c88 (more details), 2.49 Å

PDB Description: crystal structure of ard1 n-terminal acetyltransferase from sulfolobus solfataricus in monoclinic form
PDB Compounds: (B:) Uncharacterized N-acetyltransferase SSO0209

SCOPe Domain Sequences for d5c88b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c88b_ d.108.1.0 (B:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
dftlrnarmddidqiikinrltlpenypyyffvehlkeyglaffvaivdnsvvgyimpri
ewgfsnikqlpslvrkghvvsiavleeyrrkgiattlleasmksmkndynaeeiylevrv
snypaialyeklnfkkvkvlkgyyadgedaylmarpl

SCOPe Domain Coordinates for d5c88b_:

Click to download the PDB-style file with coordinates for d5c88b_.
(The format of our PDB-style files is described here.)

Timeline for d5c88b_: