| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
| Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
| Protein automated matches [190038] (49 species) not a true protein |
| Species Sulfolobus solfataricus [TaxId:273057] [267809] (6 PDB entries) |
| Domain d5c88b_: 5c88 B: [280268] Other proteins in same PDB: d5c88a2 automated match to d4lx9a_ complexed with coa |
PDB Entry: 5c88 (more details), 2.49 Å
SCOPe Domain Sequences for d5c88b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5c88b_ d.108.1.0 (B:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
dftlrnarmddidqiikinrltlpenypyyffvehlkeyglaffvaivdnsvvgyimpri
ewgfsnikqlpslvrkghvvsiavleeyrrkgiattlleasmksmkndynaeeiylevrv
snypaialyeklnfkkvkvlkgyyadgedaylmarpl
Timeline for d5c88b_: