Lineage for d1idja_ (1idj A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1806195Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1806196Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 1806243Family b.80.1.2: Pectin lyase [51133] (1 protein)
    this is a repeat family; one repeat unit is 1idj A:227-250 found in domain
  6. 1806244Protein Pectin lyase [51134] (2 species)
  7. 1806245Species Aspergillus niger, type A [TaxId:5061] [51135] (2 PDB entries)
  8. 1806247Domain d1idja_: 1idj A: [28026]

Details for d1idja_

PDB Entry: 1idj (more details), 2.4 Å

PDB Description: pectin lyase a
PDB Compounds: (A:) pectin lyase a

SCOPe Domain Sequences for d1idja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1idja_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type A [TaxId: 5061]}
vgvsgsaegfaegvtgggdatpvypdtidelvsylgddearvivltktfdftdsegtttg
tgcapwgtasacqvaidqddwcenyepdapsvsveyynagvlgitvtsnksligegssga
ikgkglrivsgaeniiiqniavtdinpkyvwggdaitlddcdlvwidhvttarigrqhyv
lgtsadnrvsltnnyidgvsdysatcdgyhywgiyldgdadlvtmkgnyiyhtsgrspkv
qdntllhcvnnyfydisghafeigeggyvlaegnvfqnvdtvletyegaaftvpsttage
vcstylgrdcvingfgcsgtfsedstsflsdfegkniasasaytsvasrvvanagqgnl

SCOPe Domain Coordinates for d1idja_:

Click to download the PDB-style file with coordinates for d1idja_.
(The format of our PDB-style files is described here.)

Timeline for d1idja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1idjb_