![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) ![]() |
![]() | Family a.93.1.1: CCP-like [48114] (5 proteins) |
![]() | Protein automated matches [190089] (9 species) not a true protein |
![]() | Species Sorghum (Sorghum bicolor) [TaxId:4558] [280251] (1 PDB entry) |
![]() | Domain d5aoga_: 5aog A: [280252] automated match to d1bgpa_ complexed with ca, gol, hem, iac, na |
PDB Entry: 5aog (more details), 1.27 Å
SCOPe Domain Sequences for d5aoga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aoga_ a.93.1.1 (A:) automated matches {Sorghum (Sorghum bicolor) [TaxId: 4558]} qpplapglsfdfykrscpkaesivrsfvqdavrrdvglaagllrlhfhdcfvqgcdasvl ldgsatgpgeqqappnltlrptafkaindihdrlhkecggtvvscsdvlalaardsvvvs ggpsyrvplgrrdsasfatqqdvlsglppptaavpallavlskinldatdlvalsgghti glghctsfedrlfprpdptlnatfagqlrrtcpakgtdrrtpldvrtpnafdnkyyvnlv nreglftsdqdlfsnartralvdkfarsqrdffdqfafsvvkmgqikvltgtqgqirtnc sarnaag
Timeline for d5aoga_: