Lineage for d1idka_ (1idk A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813492Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813493Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2813542Family b.80.1.2: Pectin lyase [51133] (1 protein)
    this is a repeat family; one repeat unit is 1idj A:227-250 found in domain
  6. 2813543Protein Pectin lyase [51134] (2 species)
  7. 2813544Species Aspergillus niger, type A [TaxId:5061] [51135] (2 PDB entries)
  8. 2813545Domain d1idka_: 1idk A: [28025]
    CASP2

Details for d1idka_

PDB Entry: 1idk (more details), 1.93 Å

PDB Description: pectin lyase a
PDB Compounds: (A:) pectin lyase a

SCOPe Domain Sequences for d1idka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1idka_ b.80.1.2 (A:) Pectin lyase {Aspergillus niger, type A [TaxId: 5061]}
vgvsgsaegfakgvtgggsatpvypdtidelvsylgddearvivltktfdftdsegtttg
tgcapwgtasacqvaidqddwcenyepdapsvsveyynagtlgitvtsnksligegssga
ikgkglrivsgaeniiiqniavtdinpkyvwggdaitlddcdlvwidhvttarigrqhyv
lgtsadnrvsltnnyidgvsdysatcdgyhywaiyldgdadlvtmkgnyiyhtsgrspkv
qdntllhavnnywydisghafeigeggyvlaegnvfqnvdtvletyegeaftvpsstage
vcstylgrdcvingfgssgtfsedstsflsdfegkniasasaytsvasrvvanagqgnl

SCOPe Domain Coordinates for d1idka_:

Click to download the PDB-style file with coordinates for d1idka_.
(The format of our PDB-style files is described here.)

Timeline for d1idka_: