Lineage for d1ee6a_ (1ee6 A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 676845Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 676846Superfamily b.80.1: Pectin lyase-like [51126] (11 families) (S)
    superhelix turns are made of 3 strands each
  5. 676847Family b.80.1.1: Pectate lyase-like [51127] (2 proteins)
    this is a repeat family; one repeat unit is 1pxz A:227-250 found in domain
  6. 676852Protein Pectate lyase [51128] (5 species)
  7. 676853Species Bacillus sp., strain ksmp15 [TaxId:1409] [51132] (1 PDB entry)
    Low-molecular weight high-alkaline enzyme
  8. 676854Domain d1ee6a_: 1ee6 A: [28024]
    complexed with ca

Details for d1ee6a_

PDB Entry: 1ee6 (more details), 2.3 Å

PDB Description: crystal structure of pectate lyase from bacillus sp. strain ksm-p15.
PDB Compounds: (A:) pectate lyase

SCOP Domain Sequences for d1ee6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ee6a_ b.80.1.1 (A:) Pectate lyase {Bacillus sp., strain ksmp15 [TaxId: 1409]}
aptvvhetirvpagqtfdgkgqtyvanpntlgdgsqaenqkpifrleagaslknvvigap
aadgvhcygdctitnviwedvgedaltlkssgtvnisggaaykaydkvfqinaagtinir
nfraddigklvrqnggttykvvmnvencnisrvkdailrtdsststgrivntrysnvptl
fkgfksgnttasgntqy

SCOP Domain Coordinates for d1ee6a_:

Click to download the PDB-style file with coordinates for d1ee6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ee6a_: