SCOP 1.69: Domain d1ee6a_: 1ee6 A:

Lineage for d1ee6a_ (1ee6 A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.80: Single-stranded right-handed beta-helix [51125] (7 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.80.1: Pectin lyase-like [51126] (11 families)
   superhelix turns are made of 3 strands each

5. Family b.80.1.1: Pectate lyase [51127] (1 protein)
   this is a repeat family; one repeat unit is 1pxz A:227-250 found in domain

6. Protein Pectate lyase [51128] (5 species)

7. Species Bacillus sp., strain ksmp15 [TaxId:1409] [51132] (1 PDB entry)
   Low-molecular weight high-alkaline enzyme

8. Domain d1ee6a_: 1ee6 A: [28024]

Details for d1ee6a_

PDB Entry: 1ee6, 2.3 Å

PDB Description: crystal structure of pectate lyase from bacillus sp. strain ksm-p15.

SCOP Domain Sequences for d1ee6a_:

Sequence; same for both SEQRES and ATOM records:

>d1ee6a_ b.80.1.1 (A:) Pectate lyase {Bacillus sp., strain ksmp15}
aptvvhetirvpagqtfdgkgqtyvanpntlgdgsqaenqkpifrleagaslknvvigap
aadgvhcygdctitnviwedvgedaltlkssgtvnisggaaykaydkvfqinaagtinir
nfraddigklvrqnggttykvvmnvencnisrvkdailrtdsststgrivntrysnvptl
fkgfksgnttasgntqy

Timeline for d1ee6a_:

• d1ee6a_ first appeared (with stable ids) in SCOP 1.55
  
• d1ee6a_ appears in SCOP 1.67
  
• d1ee6a_ appears in SCOP 1.71
  
• d1ee6a_ appears in the current release, SCOPe 2.08