![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
![]() | Protein automated matches [226859] (31 species) not a true protein |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225668] (3 PDB entries) |
![]() | Domain d5ag2c1: 5ag2 C:0-85 [280239] Other proteins in same PDB: d5ag2a2, d5ag2c2 automated match to d3dc5a1 complexed with act, azi, mli, mn, so4 |
PDB Entry: 5ag2 (more details), 1.77 Å
SCOPe Domain Sequences for d5ag2c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ag2c1 a.2.11.0 (C:0-85) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} mkhtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaia lqpalkfnggghinhsifwtnlakdg
Timeline for d5ag2c1: