Lineage for d5ag2a1 (5ag2 A:1-85)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1718782Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1719057Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1719324Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 1719325Protein automated matches [226859] (31 species)
    not a true protein
  7. 1719425Species Nematode (Caenorhabditis elegans) [TaxId:6239] [225668] (3 PDB entries)
  8. 1719430Domain d5ag2a1: 5ag2 A:1-85 [280236]
    Other proteins in same PDB: d5ag2a2, d5ag2c2
    automated match to d3dc5a1
    complexed with act, azi, mli, mn, so4

Details for d5ag2a1

PDB Entry: 5ag2 (more details), 1.77 Å

PDB Description: sod-3 azide complex
PDB Compounds: (A:) Superoxide dismutase [Mn] 2, mitochondrial

SCOPe Domain Sequences for d5ag2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ag2a1 a.2.11.0 (A:1-85) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
khtlpdlpfdyadlepvisheimqlhhqkhhatyvnnlnqieeklheavskgnlkeaial
qpalkfnggghinhsifwtnlakdg

SCOPe Domain Coordinates for d5ag2a1:

Click to download the PDB-style file with coordinates for d5ag2a1.
(The format of our PDB-style files is described here.)

Timeline for d5ag2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ag2a2