Lineage for d5afwa1 (5afw A:270-362)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785079Family b.34.13.2: Chromo domain [54165] (8 proteins)
    lacks the SH3-like barrel first strand that can be complemented by bound peptide ligand; in shadow chromo domain the corresponding site is altered by insertion; similarity to the IL8-like fold
  6. 2785156Protein automated matches [191035] (3 species)
    not a true protein
  7. 2785157Species Human (Homo sapiens) [TaxId:9606] [188859] (14 PDB entries)
  8. 2785165Domain d5afwa1: 5afw A:270-362 [280235]
    automated match to d2b2yb2
    complexed with cl, edo

Details for d5afwa1

PDB Entry: 5afw (more details), 1.6 Å

PDB Description: assembly of methylated lsd1 and chd1 drives ar-dependent transcription and translocation
PDB Compounds: (A:) Chromodomain-helicase-DNA-binding protein 1

SCOPe Domain Sequences for d5afwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5afwa1 b.34.13.2 (A:270-362) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqylikwkgwshih
ntweteetlkqqnvrgmkkldnykkkdqetkrw

SCOPe Domain Coordinates for d5afwa1:

Click to download the PDB-style file with coordinates for d5afwa1.
(The format of our PDB-style files is described here.)

Timeline for d5afwa1: