Lineage for d5adut_ (5adu T:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2624627Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2624628Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2624800Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 2624801Protein automated matches [191172] (11 species)
    not a true protein
  7. 2624833Species Escherichia coli [TaxId:562] [256126] (6 PDB entries)
  8. 2624835Domain d5adut_: 5adu T: [280234]
    Other proteins in same PDB: d5adul_, d5adum_
    automated match to d3rgws_
    complexed with cl, f3s, fco, lmt, mg, ni, sf3, sf4, so4

Details for d5adut_

PDB Entry: 5adu (more details), 1.1 Å

PDB Description: the mechanism of hydrogen activation by nife-hydrogenases
PDB Compounds: (T:) Hydrogenase-1 small chain

SCOPe Domain Sequences for d5adut_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5adut_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 562]}
kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
qsghgclgcaengfwdrgsfysrv

SCOPe Domain Coordinates for d5adut_:

Click to download the PDB-style file with coordinates for d5adut_.
(The format of our PDB-style files is described here.)

Timeline for d5adut_: