SCOPe 2.07: Domain d5adus_: 5adu S:

Lineage for d5adus_ (5adu S:)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.0: automated matches [191636] (1 protein)
   not a true family

6. Protein automated matches [191172] (11 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [256126] (6 PDB entries)

8. Domain d5adus_: 5adu S: [280233]
   Other proteins in same PDB: d5adul_, d5adum_
   automated match to d3rgws_
   complexed with cl, f3s, fco, lmt, mg, ni, sf3, sf4, so4

Details for d5adus_

PDB Entry: 5adu, 1.1 Å

PDB Description: the mechanism of hydrogen activation by nife-hydrogenases

PDB Compounds: (S:) Hydrogenase-1 small chain

SCOPe Domain Sequences for d5adus_:

Sequence; same for both SEQRES and ATOM records:

>d5adus_ e.19.1.0 (S:) automated matches {Escherichia coli [TaxId: 562]}
kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
qsghgclgcaengfwdrgsfysr

Timeline for d5adus_:

• d5adus_ first appeared in SCOPe 2.05
  
• d5adus_ appears in SCOPe 2.06
  
• d5adus_ appears in the current release, SCOPe 2.08