Lineage for d2bspa_ (2bsp A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813492Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2813493Superfamily b.80.1: Pectin lyase-like [51126] (12 families) (S)
    superhelix turns are made of 3 strands each
  5. 2813494Family b.80.1.1: Pectate lyase-like [51127] (3 proteins)
    this is a repeat family; one repeat unit is 1pxz A:227-250 found in domain
  6. 2813499Protein Pectate lyase [51128] (5 species)
  7. 2813502Species Bacillus subtilis [TaxId:1423] [51131] (2 PDB entries)
  8. 2813504Domain d2bspa_: 2bsp A: [28023]
    complexed with ca; mutant

Details for d2bspa_

PDB Entry: 2bsp (more details), 1.8 Å

PDB Description: bacillus subtilis pectate lyase r279k mutant
PDB Compounds: (A:) protein (pectate lyase)

SCOPe Domain Sequences for d2bspa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bspa_ b.80.1.1 (A:) Pectate lyase {Bacillus subtilis [TaxId: 1423]}
adlghqtlgsndgwgaystgttggskasssnvytvsnrnqlvsalgketnttpkiiyikg
tidmnvddnlkplglndykdpeydldkylkaydpstwgkkepsgtqeeararsqknqkar
vmvdipanttivgsgtnakvvggnfqiksdnviirniefqdaydyfpqwdptdgssgnwn
sqydnitinggthiwidhctfndgsrpdstspkyygrkyqhhdgqtdasnganyitmsyn
yyhdhdkssifgssdsktsddgklkitlhhnryknivqkaprvrfgqvhvynnyyegsts
sssypfsyawgigksskiyaqnnvidvpglsaaktisvfsggtalydsgtllngtqinas
aanglsssvgwtpslhgsidasanvksnvinqagagkln

SCOPe Domain Coordinates for d2bspa_:

Click to download the PDB-style file with coordinates for d2bspa_.
(The format of our PDB-style files is described here.)

Timeline for d2bspa_: