Lineage for d5a4ft_ (5a4f T:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249152Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2249153Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2249298Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 2249299Protein automated matches [191172] (7 species)
    not a true protein
  7. 2249307Species Escherichia coli [TaxId:1403831] [279531] (3 PDB entries)
  8. 2249311Domain d5a4ft_: 5a4f T: [280218]
    Other proteins in same PDB: d5a4fl_, d5a4fm_
    automated match to d3rgws_
    complexed with cl, f3s, fco, mg, ni, sf3, sf4, so4

Details for d5a4ft_

PDB Entry: 5a4f (more details), 1.25 Å

PDB Description: the mechanism of hydrogen activation by nife-hydrogenases.
PDB Compounds: (T:) Hydrogenase-1 small chain

SCOPe Domain Sequences for d5a4ft_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a4ft_ e.19.1.0 (T:) automated matches {Escherichia coli [TaxId: 1403831]}
kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
qsghgclgcaengfwdrgsfysrv

SCOPe Domain Coordinates for d5a4ft_:

Click to download the PDB-style file with coordinates for d5a4ft_.
(The format of our PDB-style files is described here.)

Timeline for d5a4ft_: