Lineage for d5a7ga_ (5a7g A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134301Protein automated matches [190065] (6 species)
    not a true protein
  7. 2134307Species Human (Homo sapiens) [TaxId:9606] [186857] (44 PDB entries)
  8. 2134308Domain d5a7ga_: 5a7g A: [280216]
    automated match to d1mx1a_
    complexed with nag

Details for d5a7ga_

PDB Entry: 5a7g (more details), 1.48 Å

PDB Description: comparison of the structure and activity of glycosylated and aglycosylated human carboxylesterase 1
PDB Compounds: (A:) Liver carboxylesterase 1

SCOPe Domain Sequences for d5a7ga_:

Sequence, based on SEQRES records: (download)

>d5a7ga_ c.69.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
vqdniasfggnpgsvtifgeaaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak

Sequence, based on observed residues (ATOM records): (download)

>d5a7ga_ c.69.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
vqdniasfggnpgsvtifgeaaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdprellgtvi
dgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsllwk
syplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdagapt
ymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwanfa
rngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak

SCOPe Domain Coordinates for d5a7ga_:

Click to download the PDB-style file with coordinates for d5a7ga_.
(The format of our PDB-style files is described here.)

Timeline for d5a7ga_: