![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
![]() | Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
![]() | Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) ![]() |
![]() | Family e.19.1.0: automated matches [191636] (1 protein) not a true family |
![]() | Protein automated matches [191172] (11 species) not a true protein |
![]() | Species Escherichia coli [TaxId:1403831] [279531] (3 PDB entries) |
![]() | Domain d5a4fs_: 5a4f S: [280214] Other proteins in same PDB: d5a4fl_, d5a4fm_ automated match to d3rgws_ complexed with cl, f3s, fco, mg, ni, sf3, sf4, so4 |
PDB Entry: 5a4f (more details), 1.25 Å
SCOPe Domain Sequences for d5a4fs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a4fs_ e.19.1.0 (S:) automated matches {Escherichia coli [TaxId: 1403831]} kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi qsghgclgcaengfwdrgsfysrv
Timeline for d5a4fs_: