Lineage for d5a7fa_ (5a7f A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134248Protein Mammalian carboxylesterase (liver carboxylesterase I) [75282] (2 species)
  7. 2134249Species Human (Homo sapiens) [TaxId:9606] [89768] (7 PDB entries)
  8. 2134256Domain d5a7fa_: 5a7f A: [280213]
    automated match to d1mx1a_
    complexed with nag, po4

Details for d5a7fa_

PDB Entry: 5a7f (more details), 1.86 Å

PDB Description: comparison of the structure and activity of glycosylated and aglycosylated human carboxylesterase 1
PDB Compounds: (A:) Liver carboxylesterase 1

SCOPe Domain Sequences for d5a7fa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a7fa_ c.69.1.1 (A:) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]}
ssppvvdtvhgkvlgkfvslegfaqpvaiflgipfakpplgplrftppqpaepwsfvkna
tsyppmctqdpkagqllselftnrkeniplklsedclylniytpadltkknrlpvmvwih
ggglmvgaastydglalaahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrw
vqdniasfggnpgsvtifgesaggesvsvlvlsplaknlfhraisesgvaltsvlvkkgd
vkplaeqiaitagcktttsavmvhclrqkteeellettlkmkflsldlqgdpresqpllg
tvidgmlllktpeelqaernfhtvpymvginkqefgwlipmlmsyplsegqldqktamsl
lwksyplvciakelipeatekylggtddtvkkkdlfldliadvmfgvpsvivarnhrdag
aptymyefqyrpsfssdmkpktvigdhgdelfsvfgapflkegaseeeirlskmvmkfwa
nfarngnpngeglphwpeynqkegylqigantqaaqklkdkevafwtnlfak

SCOPe Domain Coordinates for d5a7fa_:

Click to download the PDB-style file with coordinates for d5a7fa_.
(The format of our PDB-style files is described here.)

Timeline for d5a7fa_: