Lineage for d1pcla_ (1pcl A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 676845Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 676846Superfamily b.80.1: Pectin lyase-like [51126] (11 families) (S)
    superhelix turns are made of 3 strands each
  5. 676847Family b.80.1.1: Pectate lyase-like [51127] (2 proteins)
    this is a repeat family; one repeat unit is 1pxz A:227-250 found in domain
  6. 676852Protein Pectate lyase [51128] (5 species)
  7. 676881Species Erwinia chrysanthemi, type E [TaxId:556] [51130] (1 PDB entry)
  8. 676882Domain d1pcla_: 1pcl A: [28021]
    CA-atoms only

Details for d1pcla_

PDB Entry: 1pcl (more details), 2.2 Å

PDB Description: unusual structural features in the parallel beta-helix in pectate lyases
PDB Compounds: (A:) pectate lyase e

SCOP Domain Sequences for d1pcla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcla_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type E [TaxId: 556]}
avetdaattgwatqnggttggakaakavevknisdfkkalngtdssakiikvtgpidisg
gkaytsfddqkarsqisipsnttiigvgsngkftngslvikgvknvilrnlyietpvdva
phyesgdgwnaewdaavidnstnvwvdhvtisdgsftddkyttkdgekyvqhdgaldikk
gsdyvtisysrfelhdktilighsdsngsqdsgklrvtfhnnvfdrvteraprvrfgsih
aynnvylgdvkhsvypylysfglgtsgsilsesnsftlsnlksidgknpecsivkqfnsk
vfsdkgslvngstttkldtcgltaykptlpykysaqtmtsslatsinnnagygkl

SCOP Domain Coordinates for d1pcla_:

Click to download the PDB-style file with coordinates for d1pcla_.
(The format of our PDB-style files is described here.)

Timeline for d1pcla_: