Lineage for d1pcl__ (1pcl -)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 380828Fold b.80: Single-stranded right-handed beta-helix [51125] (7 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 380829Superfamily b.80.1: Pectin lyase-like [51126] (11 families) (S)
    superhelix turns are made of 3 strands each
  5. 380830Family b.80.1.1: Pectate lyase [51127] (1 protein)
    this is a repeat family; one repeat unit is 1pxz A:227-250 found in domain
  6. 380831Protein Pectate lyase [51128] (5 species)
  7. 380860Species Erwinia chrysanthemi, type E [TaxId:556] [51130] (1 PDB entry)
  8. 380861Domain d1pcl__: 1pcl - [28021]
    CA-atoms only

Details for d1pcl__

PDB Entry: 1pcl (more details), 2.2 Å

PDB Description: unusual structural features in the parallel beta-helix in pectate lyases

SCOP Domain Sequences for d1pcl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pcl__ b.80.1.1 (-) Pectate lyase {Erwinia chrysanthemi, type E}
avetdaattgwatqnggttggakaakavevknisdfkkalngtdssakiikvtgpidisg
gkaytsfddqkarsqisipsnttiigvgsngkftngslvikgvknvilrnlyietpvdva
phyesgdgwnaewdaavidnstnvwvdhvtisdgsftddkyttkdgekyvqhdgaldikk
gsdyvtisysrfelhdktilighsdsngsqdsgklrvtfhnnvfdrvteraprvrfgsih
aynnvylgdvkhsvypylysfglgtsgsilsesnsftlsnlksidgknpecsivkqfnsk
vfsdkgslvngstttkldtcgltaykptlpykysaqtmtsslatsinnnagygkl

SCOP Domain Coordinates for d1pcl__:

Click to download the PDB-style file with coordinates for d1pcl__.
(The format of our PDB-style files is described here.)

Timeline for d1pcl__: