Lineage for d4y1ea1 (4y1e A:2-171)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2859252Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2859253Protein automated matches [190197] (23 species)
    not a true protein
  7. 2859453Species Staphylococcus aureus [TaxId:158878] [280201] (7 PDB entries)
  8. 2859458Domain d4y1ea1: 4y1e A:2-171 [280204]
    Other proteins in same PDB: d4y1ea2, d4y1eb2
    automated match to d1oi4a1

Details for d4y1ea1

PDB Entry: 4y1e (more details), 1.8 Å

PDB Description: sav1875-c105d
PDB Compounds: (A:) Uncharacterized protein SAV1875

SCOPe Domain Sequences for d4y1ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y1ea1 c.23.16.0 (A:2-171) automated matches {Staphylococcus aureus [TaxId: 158878]}
tkkvaiilanefedieysspkealenagfntvvigdtansevvgkhgekvtvdvgiaeak
pedydallipggfspdhlrgdtegrygtfakyftkndvptfaidhgpqilidtddlkgrt
ltavlnvrkdlsnagahvvdesvvvdnnivtsrvpddlddfnreivkqlq

SCOPe Domain Coordinates for d4y1ea1:

Click to download the PDB-style file with coordinates for d4y1ea1.
(The format of our PDB-style files is described here.)

Timeline for d4y1ea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4y1ea2