SCOPe 2.08: Domain d4y1ea1: 4y1e A:2-171

Lineage for d4y1ea1 (4y1e A:2-171)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (23 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [280201] (7 PDB entries)

8. Domain d4y1ea1: 4y1e A:2-171 [280204]
   Other proteins in same PDB: d4y1ea2, d4y1eb2
   automated match to d1oi4a1

Details for d4y1ea1

PDB Entry: 4y1e, 1.8 Å

PDB Description: sav1875-c105d

PDB Compounds: (A:) Uncharacterized protein SAV1875

SCOPe Domain Sequences for d4y1ea1:

Sequence; same for both SEQRES and ATOM records:

>d4y1ea1 c.23.16.0 (A:2-171) automated matches {Staphylococcus aureus [TaxId: 158878]}
tkkvaiilanefedieysspkealenagfntvvigdtansevvgkhgekvtvdvgiaeak
pedydallipggfspdhlrgdtegrygtfakyftkndvptfaidhgpqilidtddlkgrt
ltavlnvrkdlsnagahvvdesvvvdnnivtsrvpddlddfnreivkqlq

Timeline for d4y1ea1:

• d4y1ea1 first appeared in SCOPe 2.05, called d4y1ea_
  
• d4y1ea1 appears in SCOPe 2.07