Lineage for d1plua_ (1plu A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 470209Fold b.80: Single-stranded right-handed beta-helix [51125] (7 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 470210Superfamily b.80.1: Pectin lyase-like [51126] (11 families) (S)
    superhelix turns are made of 3 strands each
  5. 470211Family b.80.1.1: Pectate lyase [51127] (1 protein)
    this is a repeat family; one repeat unit is 1pxz A:227-250 found in domain
  6. 470212Protein Pectate lyase [51128] (5 species)
  7. 470226Species Erwinia chrysanthemi, type C [TaxId:556] [51129] (14 PDB entries)
  8. 470240Domain d1plua_: 1plu A: [28020]

Details for d1plua_

PDB Entry: 1plu (more details), 2.2 Å

PDB Description: pectate lyase c from erwinia chrysanthemi with 1 lu+3 ion in the putative calcium binding site

SCOP Domain Sequences for d1plua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1plua_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type C}
atdtggyaataggnvtgavsktatsmqdivniidaarldangkkvkggayplvitytgne
dslinaaaanicgqwskdprgveikeftkgitiigangssanfgiwikkssdvvvqnmri
gylpggakdgdmirvddspnvwvdhnelfaanhecdgtpdndttfesavdikgasntvtv
synyihgvkkvgldgssssdtgrnityhhnyyndvnarlplqrgglvhaynnlytnitgs
glnvrqngqaliennwfekainpvtsrydgknfgtwvlkgnnitkpadfstysitwtadt
kpyvnadswtstgtfptvaynyspvsaqcvkdklpgyagvgknlatltstack

SCOP Domain Coordinates for d1plua_:

Click to download the PDB-style file with coordinates for d1plua_.
(The format of our PDB-style files is described here.)

Timeline for d1plua_: