Lineage for d2peca_ (2pec A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 676845Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 676846Superfamily b.80.1: Pectin lyase-like [51126] (11 families) (S)
    superhelix turns are made of 3 strands each
  5. 676847Family b.80.1.1: Pectate lyase-like [51127] (2 proteins)
    this is a repeat family; one repeat unit is 1pxz A:227-250 found in domain
  6. 676852Protein Pectate lyase [51128] (5 species)
  7. 676866Species Erwinia chrysanthemi, type C [TaxId:556] [51129] (14 PDB entries)
  8. 676876Domain d2peca_: 2pec A: [28019]

Details for d2peca_

PDB Entry: 2pec (more details), 2.2 Å

PDB Description: the refined three-dimensional structure of pectate lyase c from erwinia chrysanthemi at 2.2 angstroms resolution: implications for an enzymatic mechanism
PDB Compounds: (A:) pectate lyase c

SCOP Domain Sequences for d2peca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2peca_ b.80.1.1 (A:) Pectate lyase {Erwinia chrysanthemi, type C [TaxId: 556]}
atdtggyaataggnvtgavsktatsmqdivniidaarldangkkvkggayplvitytgne
dslinaaaanicgqwskdprgveikeftkgitiigangssanfgiwikkssdvvvqnmri
gylpggakdgdmirvddspnvwvdhnelfaanhecdgtpdndttfesavdikgasntvtv
synyihgvkkvgldgssssdtgrnityhhnyyndvnarlplqrgglvhaynnlytnitgs
glnvrqngqaliennwfekainpvtsrydgknfgtwvlkgnnitkpadfstysitwtadt
kpyvnadswtstgtfptvaynyspvsaqcvkdklpgyagvgknlatltstac

SCOP Domain Coordinates for d2peca_:

Click to download the PDB-style file with coordinates for d2peca_.
(The format of our PDB-style files is described here.)

Timeline for d2peca_: