Lineage for d4xg9b_ (4xg9 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983145Protein Tyrosine-protein kinase SYK [118131] (1 species)
    PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase
  7. 2983146Species Human (Homo sapiens) [TaxId:9606] [118132] (73 PDB entries)
    Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576)
  8. 2983228Domain d4xg9b_: 4xg9 B: [280184]
    automated match to d3tuca_
    complexed with x9g

Details for d4xg9b_

PDB Entry: 4xg9 (more details), 2.91 Å

PDB Description: crystal structure of an inhibitor-bound syk
PDB Compounds: (B:) Tyrosine-protein kinase SYK

SCOPe Domain Sequences for d4xg9b_:

Sequence, based on SEQRES records: (download)

>d4xg9b_ d.144.1.7 (B:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean
vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgm
kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyape
cinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremy
dlmnlcwtydvenrpgfaavelrlrnyyydvv

Sequence, based on observed residues (ATOM records): (download)

>d4xg9b_ d.144.1.7 (B:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkdpalkdellaeanvmqq
ldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyle
esnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthpvkwyapecinyykf
ssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcw
tydvenrpgfaavelrlrnyyydvv

SCOPe Domain Coordinates for d4xg9b_:

Click to download the PDB-style file with coordinates for d4xg9b_.
(The format of our PDB-style files is described here.)

Timeline for d4xg9b_: