Lineage for d4z6ah_ (4z6a H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2795114Protein Coagulation factor VIIa [50550] (1 species)
  7. 2795115Species Human (Homo sapiens) [TaxId:9606] [50551] (90 PDB entries)
    Uniprot P08709 213-466 ! Uniprot P08709 213-446
  8. 2795164Domain d4z6ah_: 4z6a H: [280181]
    Other proteins in same PDB: d4z6al1, d4z6al2
    automated match to d4jzeh_
    complexed with 0z6, bgc, ca, cit, fuc

Details for d4z6ah_

PDB Entry: 4z6a (more details), 2.25 Å

PDB Description: crystal structure of a fviia-trypsin chimera (yt) in complex with soluble tissue factor
PDB Compounds: (H:) Coagulation factor VII

SCOPe Domain Sequences for d4z6ah_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z6ah_ b.47.1.2 (H:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
ivggkvcpkgecpwqvlllvngaqlcggtlintiwvvsaahcfdkiknwrnliavlgehd
lsehdgdeqsrrvaqviipstyvpgttnhdiallrlhqpvvltdhvvplclpertfsert
lafvrfslvsgwgqlldrgatalelmvlnvprlmtqdceasypgkiteymfcagysdgsk
dsckgdsggphathyrgtwyltgivswgqgcatvghfgvytrvsqyiewlqklmrseprp
gvllrapfp

SCOPe Domain Coordinates for d4z6ah_:

Click to download the PDB-style file with coordinates for d4z6ah_.
(The format of our PDB-style files is described here.)

Timeline for d4z6ah_: