Lineage for d1air__ (1air -)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566895Fold b.80: Single-stranded right-handed beta-helix [51125] (7 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 566896Superfamily b.80.1: Pectin lyase-like [51126] (11 families) (S)
    superhelix turns are made of 3 strands each
  5. 566897Family b.80.1.1: Pectate lyase-like [51127] (2 proteins)
    this is a repeat family; one repeat unit is 1pxz A:227-250 found in domain
  6. 566902Protein Pectate lyase [51128] (5 species)
  7. 566916Species Erwinia chrysanthemi, type C [TaxId:556] [51129] (14 PDB entries)
  8. 566920Domain d1air__: 1air - [28018]
    complexed with so4

Details for d1air__

PDB Entry: 1air (more details), 2.2 Å

PDB Description: pectate lyase c from erwinia chrysanthemi (ec16) to a resolution of 2.2 angstroms with 128 waters

SCOP Domain Sequences for d1air__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1air__ b.80.1.1 (-) Pectate lyase {Erwinia chrysanthemi, type C}
atdtggyaataggnvtgavsktatsmqdivniidaarldangkkvkggayplvitytgne
dslinaaaanicgqwskdprgveikeftkgitiigangssanfgiwikkssdvvvqnmri
gylpggakdgdmirvddspnvwvdhnelfaanhecdgtpdndttfesavdikgasntvtv
synyihgvkkvgldgssssdtgrnityhhnyyndvnarlplqrgglvhaynnlytnitgs
glnvrqngqaliennwfekainpvtsrydgknfgtwvlkgnnitkpadfstysitwtadt
kpyvnadswtstgtfptvaynyspvsaqcvkdklpgyagvgknlatltstac

SCOP Domain Coordinates for d1air__:

Click to download the PDB-style file with coordinates for d1air__.
(The format of our PDB-style files is described here.)

Timeline for d1air__: