Lineage for d2n6ga1 (2n6g A:6-80)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208184Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 2208248Superfamily d.100.2: MbtH-like [160582] (2 families) (S)
    the first helix is replaced with an extended loop; contains extra C-terminal helix of variable position
  5. 2208258Family d.100.2.0: automated matches [254253] (1 protein)
    not a true family
  6. 2208259Protein automated matches [254578] (5 species)
    not a true protein
  7. 2208264Species Mycobacterium avium [TaxId:243243] [280169] (1 PDB entry)
  8. 2208265Domain d2n6ga1: 2n6g A:6-80 [280170]
    Other proteins in same PDB: d2n6ga2
    automated match to d2khra_

Details for d2n6ga1

PDB Entry: 2n6g (more details)

PDB Description: solution structure of an mbth-like protein from mycobacterium avium, seattle structural genomics center for infectious disease target myava.01649.c
PDB Compounds: (A:) MbtH-like protein

SCOPe Domain Sequences for d2n6ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n6ga1 d.100.2.0 (A:6-80) automated matches {Mycobacterium avium [TaxId: 243243]}
sinpfdddngsffvlvndeeqhslwpafadvpagwrvvhgeadraacleyieehwpdirp
kslrdklatgrgfdq

SCOPe Domain Coordinates for d2n6ga1:

Click to download the PDB-style file with coordinates for d2n6ga1.
(The format of our PDB-style files is described here.)

Timeline for d2n6ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2n6ga2