Lineage for d5f1pb_ (5f1p B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2096024Species Streptomyces platensis [TaxId:684832] [280152] (1 PDB entry)
  8. 2096026Domain d5f1pb_: 5f1p B: [280153]
    automated match to d3tzqd_

Details for d5f1pb_

PDB Entry: 5f1p (more details), 2.1 Å

PDB Description: crystal structure of dehydrogenase from streptomyces platensis
PDB Compounds: (B:) PtmO8

SCOPe Domain Sequences for d5f1pb_:

Sequence, based on SEQRES records: (download)

>d5f1pb_ c.2.1.0 (B:) automated matches {Streptomyces platensis [TaxId: 684832]}
vgrlegkiaivtgaasgigavtaerlaaegarvaladldavgvqtlaekirgadgthaig
ievdladpasvramvaaaveefggldilhnnaaatalassldvpvadadpevwdrtmrvn
lsgamvatqaalphliargggcvintssaaglsgdlshpayaaskaalisltrsvatqag
rsgvrcnaiapgliitrpereaayrvmlphhlttrlgrpedvasavvflasdeasfitgq
tlvvdggll

Sequence, based on observed residues (ATOM records): (download)

>d5f1pb_ c.2.1.0 (B:) automated matches {Streptomyces platensis [TaxId: 684832]}
vgrlegkiaivtgaasgigavtaerlaaegarvaladldavgvqtlaekirgadgthaig
ievdladpasvramvaaaveefggldilhnnatalassldvpvadadpevwdrtmrvnls
gamvatqaalphliargggcvintssaasgdlshpayaaskaalisltrsvatqagrsgv
rcnaiapgliitreaayrvmlphhlttrlgrpedvasavvflasdeasfitgqtlvvdgg
ll

SCOPe Domain Coordinates for d5f1pb_:

Click to download the PDB-style file with coordinates for d5f1pb_.
(The format of our PDB-style files is described here.)

Timeline for d5f1pb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5f1pa_