SCOPe 2.08: Domain d5e7ba1: 5e7b A:3-126

Lineage for d5e7ba1 (5e7b A:3-126)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)

8. Domain d5e7ba1: 5e7b A:3-126 [280147]
   Other proteins in same PDB: d5e7ba2
   automated match to d1kxtb_

Details for d5e7ba1

PDB Entry: 5e7b, 1.1 Å

PDB Description: structure of a nanobody (vhh) from camel against phage tuc2009 rbp (bppl, orf53)

PDB Compounds: (A:) nanobody nano-L06

SCOPe Domain Sequences for d5e7ba1:

Sequence; same for both SEQRES and ATOM records:

>d5e7ba1 b.1.1.1 (A:3-126) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesgggsvqaggslrlsctasgftfddsdmgwyhqapgnecelvsaifsdgstyya
dsvkgrftisrdnakntvylqmnslkpedtamyycaaatttvasppvrhvcngywgqgtq
vtvs

Timeline for d5e7ba1:

• d5e7ba1 first appeared in SCOPe 2.05, called d5e7ba_
  
• d5e7ba1 appears in SCOPe 2.07