Lineage for d5e7fa1 (5e7f A:3-126)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742101Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)
  8. 2742182Domain d5e7fa1: 5e7f A:3-126 [280146]
    Other proteins in same PDB: d5e7fa2, d5e7fb2, d5e7fc2
    automated match to d1kxtb_

Details for d5e7fa1

PDB Entry: 5e7f (more details), 2.7 Å

PDB Description: complex between lactococcal phage tuc2009 rbp head domain and a nanobody (l06)
PDB Compounds: (A:) nanobody L06

SCOPe Domain Sequences for d5e7fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e7fa1 b.1.1.1 (A:3-126) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesgggsvqaggslrlsctasgftfddsdmgwyhqapgnecelvsaifsdgstyya
dsvkgrftisrdnakntvylqmnslkpedtamyycaaatttvasppvrhvcngywgqgtq
vtvs

SCOPe Domain Coordinates for d5e7fa1:

Click to download the PDB-style file with coordinates for d5e7fa1.
(The format of our PDB-style files is described here.)

Timeline for d5e7fa1: