Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries) |
Domain d5e7fc1: 5e7f C:3-126 [280144] Other proteins in same PDB: d5e7fa2, d5e7fb2, d5e7fc2 automated match to d1kxtb_ |
PDB Entry: 5e7f (more details), 2.7 Å
SCOPe Domain Sequences for d5e7fc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e7fc1 b.1.1.1 (C:3-126) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} qvqlvesgggsvqaggslrlsctasgftfddsdmgwyhqapgnecelvsaifsdgstyya dsvkgrftisrdnakntvylqmnslkpedtamyycaaatttvasppvrhvcngywgqgtq vtvs
Timeline for d5e7fc1:
View in 3D Domains from other chains: (mouse over for more information) d5e7fa1, d5e7fa2, d5e7fb1, d5e7fb2 |