SCOPe 2.08: Domain d5e7fc1: 5e7f C:3-126

Lineage for d5e7fc1 (5e7f C:3-126)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)

8. Domain d5e7fc1: 5e7f C:3-126 [280144]
   Other proteins in same PDB: d5e7fa2, d5e7fb2, d5e7fc2
   automated match to d1kxtb_

Details for d5e7fc1

PDB Entry: 5e7f, 2.7 Å

PDB Description: complex between lactococcal phage tuc2009 rbp head domain and a nanobody (l06)

PDB Compounds: (C:) nanobody L06

SCOPe Domain Sequences for d5e7fc1:

Sequence; same for both SEQRES and ATOM records:

>d5e7fc1 b.1.1.1 (C:3-126) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlvesgggsvqaggslrlsctasgftfddsdmgwyhqapgnecelvsaifsdgstyya
dsvkgrftisrdnakntvylqmnslkpedtamyycaaatttvasppvrhvcngywgqgtq
vtvs

Timeline for d5e7fc1:

• d5e7fc1 first appeared in SCOPe 2.05, called d5e7fc_
  
• d5e7fc1 appears in SCOPe 2.07