Lineage for d5dtlf_ (5dtl F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2941021Species Lobophyllia hemprichii [TaxId:46758] [187486] (25 PDB entries)
  8. 2941095Domain d5dtlf_: 5dtl F: [280139]
    automated match to d3s05b_

Details for d5dtlf_

PDB Entry: 5dtl (more details), 2.7 Å

PDB Description: crystal structure of meos2-a69t fluorescent protein
PDB Compounds: (F:) green to red photoconvertible gpf-like protein eosfp

SCOPe Domain Sequences for d5dtlf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dtlf_ d.22.1.0 (F:) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
saikpdmkiklrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
hygnrvftkypdniqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfy
gtnfpangpvmqkktlkwepstekmyvrdgvltgdihmalllegnahyrcdfrttykake
kgvklpgyhfvdhcieilshdkdynkvklyehavahsglpdn

SCOPe Domain Coordinates for d5dtlf_:

Click to download the PDB-style file with coordinates for d5dtlf_.
(The format of our PDB-style files is described here.)

Timeline for d5dtlf_: