| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
| Family c.52.1.34: PA N-terminal domain [254166] (3 proteins) Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458 |
| Protein PA N-terminal domain [254375] (8 species) |
| Species Influenza A virus [TaxId:1305075] [280128] (1 PDB entry) |
| Domain d5cxra1: 5cxr A:1-196 [280129] Other proteins in same PDB: d5cxra2 automated match to d4ln7a_ complexed with byz, edo, mn, so4 |
PDB Entry: 5cxr (more details), 2 Å
SCOPe Domain Sequences for d5cxra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cxra1 c.52.1.34 (A:1-196) PA N-terminal domain {Influenza A virus [TaxId: 1305075]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfiderges
iivesgdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfiei
gvtrrevhiyylekankiksekthihifsftgeematkadytldeesrariktrlftirq
emasrslwdsfrqser
Timeline for d5cxra1: