Lineage for d5cxra1 (5cxr A:1-196)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882703Family c.52.1.34: PA N-terminal domain [254166] (3 proteins)
    Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458
  6. 2882707Protein PA N-terminal domain [254375] (8 species)
  7. 2882733Species Influenza A virus [TaxId:1305075] [280128] (1 PDB entry)
  8. 2882734Domain d5cxra1: 5cxr A:1-196 [280129]
    Other proteins in same PDB: d5cxra2
    automated match to d4ln7a_
    complexed with byz, edo, mn, so4

Details for d5cxra1

PDB Entry: 5cxr (more details), 2 Å

PDB Description: influenza endonuclease complexed with 4-bromopyrazole
PDB Compounds: (A:) endonuclease

SCOPe Domain Sequences for d5cxra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cxra1 c.52.1.34 (A:1-196) PA N-terminal domain {Influenza A virus [TaxId: 1305075]}
medfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfiderges
iivesgdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfiei
gvtrrevhiyylekankiksekthihifsftgeematkadytldeesrariktrlftirq
emasrslwdsfrqser

SCOPe Domain Coordinates for d5cxra1:

Click to download the PDB-style file with coordinates for d5cxra1.
(The format of our PDB-style files is described here.)

Timeline for d5cxra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5cxra2