SCOPe 2.06: Domain d5cbsd1: 5cbs D:0-259

Lineage for d5cbsd1 (5cbs D:0-259)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (134 PDB entries)

8. Domain d5cbsd1: 5cbs D:0-259 [280124]
   Other proteins in same PDB: d5cbsc2, d5cbsd2
   automated match to d4igta_
   complexed with cl, e42, edo, gol, so4

Details for d5cbsd1

PDB Entry: 5cbs, 1.8 Å

PDB Description: crystal structure of the glua2 ligand-binding domain (s1s2j) in complex with the antagonist (r)-2-amino-3-(3'-hydroxybiphenyl-3-yl) propanoic acid at 1.8a resolution

PDB Compounds: (D:) Glutamate receptor 2,Glutamate receptor 2

SCOPe Domain Sequences for d5cbsd1:

Sequence; same for both SEQRES and ATOM records:

>d5cbsd1 c.94.1.1 (D:0-259) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgecg

Timeline for d5cbsd1:

• d5cbsd1 first appeared in SCOPe 2.05, called d5cbsd_
  
• d5cbsd1 appears in SCOPe 2.07
  
• d5cbsd1 appears in the current release, SCOPe 2.08