Lineage for d5c3nb_ (5c3n B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2390288Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2390289Protein automated matches [190438] (26 species)
    not a true protein
  7. 2390468Species Middle east respiratory syndrome coronavirus [TaxId:1335626] [272740] (8 PDB entries)
  8. 2390484Domain d5c3nb_: 5c3n B: [280119]
    automated match to d2ynaa_

Details for d5c3nb_

PDB Entry: 5c3n (more details), 3 Å

PDB Description: crystal structure of mers coronavirus main protease in spacegroup c2221
PDB Compounds: (B:) Orf1a protein

SCOPe Domain Sequences for d5c3nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5c3nb_ b.47.1.0 (B:) automated matches {Middle east respiratory syndrome coronavirus [TaxId: 1335626]}
sglvkmshpsgdveacmvqvtcgsmtlnglwldntvwcprhvmcpadqlsdpnydallis
mtnhsfsvqkhigapanlrvvghamqgtllkltvdvanpstpaytfttvkpgaafsvlac
yngrptgtftvvmrpnytikgsflcgscgsvgytkegsvinfcymhqmelangthtgsaf
dgtmygafmdkqvhqvqltdkycsvnvvawlyaailngcawfvkpnrtsvvsfnewalan
qftefvgtqsvdmlavktgvaieqllyaiqqlytgfqgkqilgstmledeftpedvnmqi

SCOPe Domain Coordinates for d5c3nb_:

Click to download the PDB-style file with coordinates for d5c3nb_.
(The format of our PDB-style files is described here.)

Timeline for d5c3nb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5c3na_