Lineage for d4ypqa_ (4ypq A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1747085Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1747086Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1748271Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 1748272Protein automated matches [191142] (5 species)
    not a true protein
  7. 1748280Species Human (Homo sapiens) [TaxId:9606] [189274] (19 PDB entries)
  8. 1748303Domain d4ypqa_: 4ypq A: [280108]
    automated match to d3l0la_
    complexed with 4f1, mg

Details for d4ypqa_

PDB Entry: 4ypq (more details), 2.32 Å

PDB Description: crystal structure of the ror(gamma)t ligand binding domain in complex with 4-(1-(2-chloro-6-(trifluoromethyl)benzoyl)-1h-indazol-3-yl) benzoic acid
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d4ypqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ypqa_ a.123.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyke
lfs

SCOPe Domain Coordinates for d4ypqa_:

Click to download the PDB-style file with coordinates for d4ypqa_.
(The format of our PDB-style files is described here.)

Timeline for d4ypqa_: