SCOPe 2.06: Domain d4xt2b_: 4xt2 B:

Lineage for d4xt2b_ (4xt2 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187434] (22 PDB entries)

8. Domain d4xt2b_: 4xt2 B: [280107]
   Other proteins in same PDB: d4xt2a1, d4xt2a2, d4xt2c1, d4xt2c2
   automated match to d1x0oa_
   complexed with 43l

Details for d4xt2b_

PDB Entry: 4xt2, 1.7 Å

PDB Description: crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with a tetrazole-containing antagonist

PDB Compounds: (B:) Aryl hydrocarbon receptor nuclear translocator

SCOPe Domain Sequences for d4xt2b_:

Sequence; same for both SEQRES and ATOM records:

>d4xt2b_ d.110.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvvk
lkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvknss

Timeline for d4xt2b_:

• d4xt2b_ first appeared in SCOPe 2.05
  
• d4xt2b_ appears in SCOPe 2.07
  
• d4xt2b_ appears in the current release, SCOPe 2.08