SCOPe 2.08: Domain d4xt2c1: 4xt2 C:239-349

Lineage for d4xt2c1 (4xt2 C:239-349)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 proteins)
   contains PAC motif

6. Protein automated matches [191006] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188753] (22 PDB entries)

8. Domain d4xt2c1: 4xt2 C:239-349 [280105]
   Other proteins in same PDB: d4xt2a2, d4xt2b_, d4xt2c2, d4xt2d_
   automated match to d3h82a_
   complexed with 43l

Details for d4xt2c1

PDB Entry: 4xt2, 1.7 Å

PDB Description: crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with a tetrazole-containing antagonist

PDB Compounds: (C:) Endothelial PAS domain-containing protein 1

SCOPe Domain Sequences for d4xt2c1:

Sequence; same for both SEQRES and ATOM records:

>d4xt2c1 d.110.3.7 (C:239-349) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct
kgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseiek

Timeline for d4xt2c1:

• d4xt2c1 first appeared in SCOPe 2.05, called d4xt2c_
  
• d4xt2c1 appears in SCOPe 2.07