Lineage for d4xt2c1 (4xt2 C:239-349)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970552Family d.110.3.7: Hypoxia-inducible factor Hif2a, C-terminal domain [103184] (2 proteins)
    contains PAC motif
  6. 2970556Protein automated matches [191006] (1 species)
    not a true protein
  7. 2970557Species Human (Homo sapiens) [TaxId:9606] [188753] (22 PDB entries)
  8. 2970570Domain d4xt2c1: 4xt2 C:239-349 [280105]
    Other proteins in same PDB: d4xt2a2, d4xt2b_, d4xt2c2, d4xt2d_
    automated match to d3h82a_
    complexed with 43l

Details for d4xt2c1

PDB Entry: 4xt2 (more details), 1.7 Å

PDB Description: crystal structure of the high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains in complex with a tetrazole-containing antagonist
PDB Compounds: (C:) Endothelial PAS domain-containing protein 1

SCOPe Domain Sequences for d4xt2c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xt2c1 d.110.3.7 (C:239-349) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqnlct
kgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseiek

SCOPe Domain Coordinates for d4xt2c1:

Click to download the PDB-style file with coordinates for d4xt2c1.
(The format of our PDB-style files is described here.)

Timeline for d4xt2c1: