Lineage for d4x4zb_ (4x4z B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2742496Domain d4x4zb_: 4x4z B: [280101]
    automated match to d1fvca_
    mutant

Details for d4x4zb_

PDB Entry: 4x4z (more details), 1.8 Å

PDB Description: retrofitting antibodies with stabilizing mutations. herceptin vl mutant f53d.
PDB Compounds: (B:) Herceptin VL domain with F53D mutation

SCOPe Domain Sequences for d4x4zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4x4zb_ b.1.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasdlysgvpsr
fsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveik

SCOPe Domain Coordinates for d4x4zb_:

Click to download the PDB-style file with coordinates for d4x4zb_.
(The format of our PDB-style files is described here.)

Timeline for d4x4zb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4x4za_