Lineage for d4xdxa_ (4xdx A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890825Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1890826Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1890827Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 1890861Protein Interleukin-8, IL-8 [54119] (1 species)
  7. 1890862Species Human (Homo sapiens) [TaxId:9606] [54120] (11 PDB entries)
  8. 1890863Domain d4xdxa_: 4xdx A: [280089]
    automated match to d1il8a_

Details for d4xdxa_

PDB Entry: 4xdx (more details), 0.95 Å

PDB Description: the crystal structure of soluble human interleukin 8 expressed in pichia pastoris
PDB Compounds: (A:) interleukin-8

SCOPe Domain Sequences for d4xdxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xdxa_ d.9.1.1 (A:) Interleukin-8, IL-8 {Human (Homo sapiens) [TaxId: 9606]}
kelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqrvv
ekflkraens

SCOPe Domain Coordinates for d4xdxa_:

Click to download the PDB-style file with coordinates for d4xdxa_.
(The format of our PDB-style files is described here.)

Timeline for d4xdxa_: