![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins) |
![]() | Protein automated matches [190880] (5 species) not a true protein |
![]() | Species Sphingobium japonicum [TaxId:452662] [280072] (2 PDB entries) |
![]() | Domain d4wdrb_: 4wdr B: [280074] automated match to d1k63a_ complexed with ca, cl; mutant |
PDB Entry: 4wdr (more details), 2.5 Å
SCOPe Domain Sequences for d4wdrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wdrb_ c.69.1.8 (B:) automated matches {Sphingobium japonicum [TaxId: 452662]} gakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrliacdl igmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarrhre rvqgiaymeaiampieaadlpeqdrdlfqafrsqageelvlqdnvfveqvlpgwilrpls eaemaayrepflaagearrptlswprqlpiagtpadvvaiardyagwlsespipklfina epgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrp
Timeline for d4wdrb_: