Lineage for d4wdrb_ (4wdr B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900279Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)
  6. 2900319Protein automated matches [190880] (5 species)
    not a true protein
  7. 2900374Species Sphingobium japonicum [TaxId:452662] [280072] (2 PDB entries)
  8. 2900377Domain d4wdrb_: 4wdr B: [280074]
    automated match to d1k63a_
    complexed with ca, cl; mutant

Details for d4wdrb_

PDB Entry: 4wdr (more details), 2.5 Å

PDB Description: crystal structure of haloalkane dehalogenase linb 140a+143l+177w+211l mutant (linb86) from sphingobium japonicum ut26
PDB Compounds: (B:) haloalkane dehalogenase

SCOPe Domain Sequences for d4wdrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wdrb_ c.69.1.8 (B:) automated matches {Sphingobium japonicum [TaxId: 452662]}
gakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrliacdl
igmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarrhre
rvqgiaymeaiampieaadlpeqdrdlfqafrsqageelvlqdnvfveqvlpgwilrpls
eaemaayrepflaagearrptlswprqlpiagtpadvvaiardyagwlsespipklfina
epgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrp

SCOPe Domain Coordinates for d4wdrb_:

Click to download the PDB-style file with coordinates for d4wdrb_.
(The format of our PDB-style files is described here.)

Timeline for d4wdrb_: