Lineage for d4rade_ (4rad E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891453Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (3 species)
  7. 2891454Species Human (Homo sapiens) [TaxId:9606] [53284] (20 PDB entries)
  8. 2891483Domain d4rade_: 4rad E: [280065]
    automated match to d3gepa_
    complexed with 3l5, mg

Details for d4rade_

PDB Entry: 4rad (more details), 2 Å

PDB Description: aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6- oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents
PDB Compounds: (E:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d4rade_:

Sequence, based on SEQRES records: (download)

>d4rade_ c.61.1.1 (E:) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]}
rspgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiv
alcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddls
tltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfei
pdkfvvgyaldyneyfrdlnhvcvisetgkakyka

Sequence, based on observed residues (ATOM records): (download)

>d4rade_ c.61.1.1 (E:) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]}
rspgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiv
alcvlkggykffadlldyikalnrnsdrsipmtvdfirlksygdikviggddlstltgkn
vlivediidtgktmqtllslvrqynpkmvkvasllvkrtpgykpdfvgfeipdkfvvgya
ldyneyfrdlnhvcvisetgkakyka

SCOPe Domain Coordinates for d4rade_:

Click to download the PDB-style file with coordinates for d4rade_.
(The format of our PDB-style files is described here.)

Timeline for d4rade_: