SCOPe 2.08: Domain d4raca_: 4rac A:

Lineage for d4raca_ (4rac A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Hypoxanthine-guanine PRTase (HGPRTase) [53283] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53284] (20 PDB entries)

8. Domain d4raca_: 4rac A: [280046]
   automated match to d3gepa_
   complexed with 3l4, mg

Details for d4raca_

PDB Entry: 4rac, 2.05 Å

PDB Description: aza-acyclic nucleoside phosphonates containing a second phosphonate group as inhibitors of the human, plasmodium falciparum and vivax 6- oxopurine phosphoribosyltransferases and their pro-drugs as antimalarial agents

PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d4raca_:

Sequence, based on SEQRES records:

>d4raca_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]}
spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
lcvlkggykffadlldyikalnrnsdrsipmtvdfirlksycndqstgdikviggddlst
ltgknvlivediidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeip
dkfvvgyaldyneyfrdlnhvcvisetgkakyka

Sequence, based on observed residues (ATOM records):

>d4raca_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]}
spgvvisddepgydldlfcipnhyaedlervfiphglimdrterlardvmkemgghhiva
lcvlkggykffadlldyikalnrnsdrsipmtvdfirlkikviggddlstltgknvlive
diidtgktmqtllslvrqynpkmvkvasllvkrtprsvgykpdfvgfeipdkfvvgyald
yneyfrdlnhvcvisetgkakyka

Timeline for d4raca_:

• d4raca_ first appeared in SCOPe 2.05
  
• d4raca_ appears in SCOPe 2.07