| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
| Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
| Protein automated matches [190896] (11 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [272199] (3 PDB entries) |
| Domain d2mqoa_: 2mqo A: [280035] automated match to d3r27a_ protein/RNA complex |
PDB Entry: 2mqo (more details)
SCOPe Domain Sequences for d2mqoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mqoa_ d.58.7.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
genyddphktpaspvvhirglidgvveadlvealqefgpisyvvvmpkkrqalvefedvl
gacnavnyaadnqiyiaghpafvnystsqkisrpgdsddsrsvns
Timeline for d2mqoa_: