SCOPe 2.07: Domain d5f6ra1: 5f6r A:1-170

Lineage for d5f6ra1 (5f6r A:1-170)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
   contains two additional beta-strands in the N-terminal extension

6. Protein automated matches [191220] (4 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [280026] (2 PDB entries)

8. Domain d5f6ra1: 5f6r A:1-170 [280027]
   Other proteins in same PDB: d5f6ra2, d5f6rb2
   automated match to d1mkaa_
   complexed with 5vo, po4

Details for d5f6ra1

PDB Entry: 5f6r, 1.18 Å

PDB Description: co-crystal structure of 3-hydroxydecanoyl-(acyl carrier protein) dehydratase from yersinia pestis with 5-benzoylpentanoic acid

PDB Compounds: (A:) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase

SCOPe Domain Sequences for d5f6ra1:

Sequence; same for both SEQRES and ATOM records:

>d5f6ra1 d.38.1.2 (A:1-170) automated matches {Yersinia pestis [TaxId: 214092]}
mvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyveaeld
inpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlp
dakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtn

Timeline for d5f6ra1:

• d5f6ra1 first appeared in SCOPe 2.05, called d5f6ra_
  
• d5f6ra1 appears in SCOPe 2.06
  
• d5f6ra1 appears in the current release, SCOPe 2.08