Lineage for d5f6ra1 (5f6r A:1-170)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943682Family d.38.1.2: beta-Hydroxydecanol thiol ester dehydrase [54641] (2 proteins)
    contains two additional beta-strands in the N-terminal extension
  6. 2943693Protein automated matches [191220] (4 species)
    not a true protein
  7. 2943750Species Yersinia pestis [TaxId:214092] [280026] (2 PDB entries)
  8. 2943751Domain d5f6ra1: 5f6r A:1-170 [280027]
    Other proteins in same PDB: d5f6ra2, d5f6rb2
    automated match to d1mkaa_
    complexed with 5vo, po4

Details for d5f6ra1

PDB Entry: 5f6r (more details), 1.18 Å

PDB Description: co-crystal structure of 3-hydroxydecanoyl-(acyl carrier protein) dehydratase from yersinia pestis with 5-benzoylpentanoic acid
PDB Compounds: (A:) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase

SCOPe Domain Sequences for d5f6ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f6ra1 d.38.1.2 (A:1-170) automated matches {Yersinia pestis [TaxId: 214092]}
mvdkresytkedleasgrgelfgaggpplpagnmlmmdrivkmiedggshnkgyveaeld
inpdlwffgchfigdpvmpgclgldamwqlvgfylgwlggegkgralgvgevkftgqvlp
dakkvtyrinfkrvimrklimgvadgevlvdgkviytatdlkvglfkdtn

SCOPe Domain Coordinates for d5f6ra1:

Click to download the PDB-style file with coordinates for d5f6ra1.
(The format of our PDB-style files is described here.)

Timeline for d5f6ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5f6ra2