SCOPe 2.06: Domain d5f3mb1: 5f3m B:2-120

Lineage for d5f3mb1 (5f3m B:2-120)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.3: DHN aldolase/epimerase [55628] (3 proteins)
   beta-sheets of four subunits form a barrel, closed: n=16, S=16
   automatically mapped to Pfam PF02152

6. Protein 7,8-dihydroneopterin aldolase [55629] (4 species)

7. Species Bacillus anthracis [TaxId:261594] [280019] (1 PDB entry)

8. Domain d5f3mb1: 5f3m B:2-120 [280020]
   Other proteins in same PDB: d5f3ma2, d5f3mb2
   automated match to d1dhna_
   complexed with cl, edo, fmt, neu, ni

Details for d5f3mb1

PDB Entry: 5f3m, 1.5 Å

PDB Description: crystal structure of dihydroneopterin aldolase from bacillus anthracis complexed with l-neopterin at 1.5 angstroms resolution .

PDB Compounds: (B:) 7,8-dihydroneopterin aldolase

SCOPe Domain Sequences for d5f3mb1:

Sequence; same for both SEQRES and ATOM records:

>d5f3mb1 d.96.1.3 (B:2-120) 7,8-dihydroneopterin aldolase {Bacillus anthracis [TaxId: 261594]}
dkiyihdmefygyhgvfpeenklgqrfkvdltveldlkragesddlehsvnygelfelcr
kvvedrtyklvesiaeniatdilkqyesisrctikvikpdppipghyravaveitrerp

Timeline for d5f3mb1:

• d5f3mb1 first appeared in SCOPe 2.05, called d5f3mb_
  
• d5f3mb1 appears in SCOPe 2.07
  
• d5f3mb1 appears in the current release, SCOPe 2.08