SCOPe 2.06: Domain d5ehua_: 5ehu A:

Lineage for d5ehua_ (5ehu A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein Green fluorescent protein, GFP [54513] (4 species)

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (177 PDB entries)
   Uniprot P42212

8. Domain d5ehua_: 5ehu A: [280018]
   automated match to d2b3pa_
   mutant

Details for d5ehua_

PDB Entry: 5ehu, 1.45 Å

PDB Description: sfgfp mutant with unnatural amino acid 4-azidoethoxy-l-phenylalanine incorporated at the 149 site

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d5ehua_:

Sequence; same for both SEQRES and ATOM records:

>d5ehua_ d.22.1.1 (A:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
skgeelftgvvpilveldgdvnghkfsvrgegegdatngkltlkficttgklpvpwptlv
ttlgygvqcfsrypdhmkrhdffksampegyvqertisfkddgtyktraevkfegdtlvn
rielkgidfkedgnilghkleynfnshxvyitadkqkngikanfkirhnvedgsvqladh
yqqntpigdgpvllpdnhylstqsvlskdpnekrdhmvllefvtaagithg

Timeline for d5ehua_:

• d5ehua_ first appeared in SCOPe 2.05
  
• d5ehua_ appears in SCOPe 2.07
  
• d5ehua_ appears in the current release, SCOPe 2.08