Lineage for d5ddrd_ (5ddr D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2558726Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2559051Protein Splicesomal U1A protein [54932] (2 species)
    duplication: contains two domains of this fold
  7. 2559056Species Human (Homo sapiens) [TaxId:9606] [54933] (54 PDB entries)
    Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98
  8. 2559111Domain d5ddrd_: 5ddr D: [280008]
    automated match to d1dz5a_
    protein/RNA complex; complexed with cs, gln, k, mg, na

Details for d5ddrd_

PDB Entry: 5ddr (more details), 2.61 Å

PDB Description: l-glutamine riboswitch bound with l-glutamine soaked with cs+
PDB Compounds: (D:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d5ddrd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ddrd_ d.58.7.1 (D:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
etrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevss
atnalrsmqgfpfydkpmriqyaktdsdiiakmk

SCOPe Domain Coordinates for d5ddrd_:

Click to download the PDB-style file with coordinates for d5ddrd_.
(The format of our PDB-style files is described here.)

Timeline for d5ddrd_: