| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
| Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
| Protein Splicesomal U1A protein [54932] (2 species) duplication: contains two domains of this fold |
| Species Human (Homo sapiens) [TaxId:9606] [54933] (54 PDB entries) Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98 |
| Domain d5ddpc_: 5ddp C: [280005] automated match to d1dz5a_ protein/RNA complex; complexed with gln, mg, na |
PDB Entry: 5ddp (more details), 2.3 Å
SCOPe Domain Sequences for d5ddpc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ddpc_ d.58.7.1 (C:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiak
Timeline for d5ddpc_: