Lineage for d5by2a1 (5by2 A:1-193)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.80: SIS domain [53696] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345Superfamily c.80.1: SIS domain [53697] (4 families) 
Family c.80.1.3: mono-SIS domain [69599] (6 proteins)
dimer of mono-domain subunits
Protein automated matches [190898] (4 species)
not a true protein
Species Colwellia psychrerythraea [TaxId:167879] [279998] (1 PDB entry) 
Domain d5by2a1: 5by2 A:1-193 [279999]
Other proteins in same PDB: d5by2a2
automated match to d2yvaa_
Details for d5by2a1
PDB Entry: 5by2 (more details), 2.8 Å
PDB Description: sedoheptulose 7-phosphate isomerase from colwellia psychrerythraea strain 34h
PDB Compounds: (A:) Phosphoheptose isomeraseSCOPe Domain Sequences for d5by2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5by2a1 c.80.1.3 (A:1-193) automated matches {Colwellia psychrerythraea [TaxId: 167879]}
mleqiknnftesiqtqiaasellgpsiehagmmmvqcllggnkiiscgnggsaghaqhfc
aqllnkyeterpslpaislnsdistitsiandyqydevfskqiralghngdvllaistsg
nsrnvvkaiesavsrdipiialtgfdggdisgllgegdveirvpsartsriqevhlvvlh
slceiidttlfpq
SCOPe Domain Coordinates for d5by2a1:
Click to download the PDB-style file with coordinates for d5by2a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5by2a1:
- d5by2a1 first appeared in SCOPe 2.05, called d5by2a_
- d5by2a1 appears in SCOPe 2.07
View in 3D
