![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
![]() | Superfamily c.80.1: SIS domain [53697] (4 families) ![]() |
![]() | Family c.80.1.3: mono-SIS domain [69599] (6 proteins) dimer of mono-domain subunits |
![]() | Protein automated matches [190898] (4 species) not a true protein |
![]() | Species Colwellia psychrerythraea [TaxId:167879] [279998] (1 PDB entry) |
![]() | Domain d5by2a1: 5by2 A:1-193 [279999] Other proteins in same PDB: d5by2a2 automated match to d2yvaa_ |
PDB Entry: 5by2 (more details), 2.8 Å
SCOPe Domain Sequences for d5by2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5by2a1 c.80.1.3 (A:1-193) automated matches {Colwellia psychrerythraea [TaxId: 167879]} mleqiknnftesiqtqiaasellgpsiehagmmmvqcllggnkiiscgnggsaghaqhfc aqllnkyeterpslpaislnsdistitsiandyqydevfskqiralghngdvllaistsg nsrnvvkaiesavsrdipiialtgfdggdisgllgegdveirvpsartsriqevhlvvlh slceiidttlfpq
Timeline for d5by2a1: